Tesamorelin

GHRH analog FDA-approved for HIV-associated lipodystrophy

FDA Approved 🛑 WADA Banned 18 views

🛑 WADA BANNED - Prohibited in competitive sports as growth hormone releasing agent

Overview

Tesamorelin is a synthetic growth hormone-releasing hormone (GHRH) analog consisting of 44 amino acids, FDA-approved under the brand name Egrifta for reducing excess abdominal visceral adipose tissue in HIV-infected patients with lipodystrophy. The peptide works by stimulating the pituitary gland to produce and secrete endogenous growth hormone in physiological pulsatile patterns. Clinical trials demonstrate significant reduction in visceral adipose tissue (VAT) while preserving subcutaneous fat and lean body mass. Research indicates improvements in trunk fat, waist circumference, and metabolic parameters including triglycerides and cholesterol. Unlike exogenous growth hormone administration, tesamorelin maintains feedback regulation and produces more natural GH secretion patterns. The peptide requires daily subcutaneous injection. Beyond its approved indication, tesamorelin is researched for age-related body composition changes, cognitive function in aging, and non-alcoholic fatty liver disease. It is generally well-tolerated with injection site reactions being the most common adverse effect.

Tesamorelin peptide molecular structure diagram for research - GHRH analogue that reduces visceral fat

Quick Facts

Formula:C221H364N72O67S
Molecular Weight:5135.86
Sequence:MAADSQTPWLLTFSLLCLLWPQEAGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRIGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFAESSCAF
Mechanism:GHRH analogue that reduces visceral fat

⚠️ Safety Information

FDA approved with established safety profile for HIV-associated lipodystrophy.