Melanotan

FDA Approved 19 views

Overview

Melanotan II is an analog that is a derivative of a precursor of melanocyte stimulating hormone (a-MSH). It seeks out melanocortin receptors, primarily MC1R in the skin and MC4R in the brain. On the skin side, it ramps up tyrosinase within melanocytes, cranks out eumelanin and revs up the handoff of that pigment to nearby keratinocytes. Translation: You tan with less sun and the color lasts longer. Melanocortin tone can also affect libido and appetite, so users may find themselves feeling extra lusty and a little less hungry. The molecule is 'cyclic' and very receptor efficient, so small amounts can give clear effects.

Melanotan peptide molecular structure diagram for research - Activates MC1R (tanning) and MC4R (sexual arousal)

Quick Facts

Formula:C50H69N15O9
Molecular Weight:1024.18
Sequence:MACPSLACCLLGLLALTSACYIQNCPLGGKRAALDLDMRKCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCATAGICCSPDGCRTDPACDPESAFSER
Mechanism:Activates MC1R (tanning) and MC4R (sexual arousal)

⚠️ Safety Information

Research compound only. Not approved as a drug in the United States. Regular skin checks recommended due to mole darkening effects. Not a substitute for sun protection.

Research Citations

Melanotan Tanning Injection: A Rare Cause of Priapism.

Mallory CW, Lopategui DM, Cordon BH (2021)

Melanotan-induced priapism: a hard-earned tan.

Dreyer BA, Amer T, Fraser M (2019)

Melanotan-associated melanoma.

Paurobally D, Jason F, Dezfoulian B, Nikkels AF (2011)

+ 20 more citations