Melanotan
FDA Approved 19 views
Overview
Melanotan II is an analog that is a derivative of a precursor of melanocyte stimulating hormone (a-MSH). It seeks out melanocortin receptors, primarily MC1R in the skin and MC4R in the brain. On the skin side, it ramps up tyrosinase within melanocytes, cranks out eumelanin and revs up the handoff of that pigment to nearby keratinocytes. Translation: You tan with less sun and the color lasts longer. Melanocortin tone can also affect libido and appetite, so users may find themselves feeling extra lusty and a little less hungry. The molecule is 'cyclic' and very receptor efficient, so small amounts can give clear effects.

Quick Facts
Formula:C50H69N15O9
Molecular Weight:1024.18
Sequence:MACPSLACCLLGLLALTSACYIQNCPLGGKRAALDLDMRKCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCATAGICCSPDGCRTDPACDPESAFSER
Mechanism:Activates MC1R (tanning) and MC4R (sexual arousal)
⚠️ Safety Information
Research compound only. Not approved as a drug in the United States. Regular skin checks recommended due to mole darkening effects. Not a substitute for sun protection.
Research Citations
Melanotan Tanning Injection: A Rare Cause of Priapism.
Mallory CW, Lopategui DM, Cordon BH (2021)
Melanotan-induced priapism: a hard-earned tan.
Dreyer BA, Amer T, Fraser M (2019)
Melanotan II: a possible cause of renal infarction: review of the literature and case report.
Peters B, Hadimeri H, Wahlberg R, Afghahi H (2020)
Melanotan-associated melanoma.
Paurobally D, Jason F, Dezfoulian B, Nikkels AF (2011)
Melanotan-II reverses memory impairment induced by a short-term HF diet.
Wekwejt P, Wojda U, Kiryk A (2023)
+ 20 more citations