LL-37

Antimicrobial peptide with immune and healing properties

🛑 WADA Banned 16 views

🛑 WADA BANNED - Prohibited in competitive sports as immune modulating peptide

Overview

LL-37 is the only cathelicidin-derived antimicrobial peptide in humans, processed from the C-terminus of the precursor protein hCAP18 (human cationic antimicrobial protein 18). This 37-amino acid peptide beginning with two leucines represents a critical component of innate immunity found in neutrophils, epithelial cells, and various body fluids. LL-37 exhibits broad-spectrum antimicrobial activity against bacteria, fungi, and viruses through membrane disruption and immunomodulatory mechanisms. Beyond direct antimicrobial effects, research demonstrates LL-37 promotes wound healing, stimulates angiogenesis, modulates inflammatory responses, and influences adaptive immunity. The peptide can neutralize bacterial lipopolysaccharide (LPS), reducing inflammatory signaling. Studies indicate potential applications in wound healing, infection control, and inflammatory conditions. LL-37 expression is induced by vitamin D, linking vitamin D status to immune function. Dysregulation of LL-37 has been implicated in various conditions including rosacea, psoriasis, and atherosclerosis, highlighting its complex role in health and disease.

LL-37 peptide molecular structure diagram for research - Antimicrobial peptide with immune-modulating properties

Quick Facts

Formula:C205H340N60O53
Molecular Weight:4493.33
Sequence:[LL-37, 37 aa]
Mechanism:Antimicrobial peptide with immune-modulating properties

⚠️ Safety Information

Research compound only. Limited human safety data available.

Research Citations

Decoding LL-37: Structure and antimicrobial mechanisms against microbial threats.

Alireza Neshani, Hosna Zare, Nooshin Sadat Ghiasi, Mohammad Ali Karimi, Mahdi Hosseini Bafghi (2025)

Host defense peptides as a new drug lead to a strategy for inflammatory bowel disease.

Júlia Morales Rodrigues, Ana Paula Ferreira Leal, Danieli Fernanda Buccini, Octavio Luiz Franco (2025)

+ 48 more citations