Liraglutide
GLP-1 agonist for diabetes and weight management
FDA Approved 12 views
Overview
Liraglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist with 97% amino acid sequence homology to native human GLP-1, modified with a fatty acid side chain enabling once-daily dosing through albumin binding. FDA-approved as Victoza for type 2 diabetes and Saxenda for chronic weight management, liraglutide works by enhancing glucose-dependent insulin secretion, suppressing glucagon release, slowing gastric emptying, and reducing appetite through central satiety pathways. Clinical trials demonstrate significant improvements in glycemic control (HbA1c reduction), body weight loss, and cardiovascular outcomes. The LEADER trial established cardiovascular safety and showed reduction in major adverse cardiovascular events. Research indicates benefits for non-alcoholic steatohepatitis (NASH) and potential neuroprotective effects. Liraglutide is administered via subcutaneous injection with gradual dose titration to minimize gastrointestinal side effects including nausea. The peptide represented a major advancement in incretin-based therapies and paved the way for newer, more potent GLP-1 receptor agonists.

Quick Facts
Formula:C172H265N43O51
Molecular Weight:3751.20
Sequence:MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Mechanism:GLP-1 receptor agonist for weight loss and diabetes management
⚠️ Safety Information
FDA approved for diabetes and obesity. Well-established safety profile.
Research Citations
Liraglutide for the Treatment of Obesity: Analyzing Published Reviews.
Pastor R, Tur JA (2019)
Liraglutide attenuates type 2 diabetes mellitus-associated non-alcoholic fatty liver disease by activating AMPK/ACC signaling and inhibiting ferroptosis.
Guo T, Yan W, Cui X, Liu N, Wei X, Sun Y, Fan K, Liu J, Zhu Y, Wang Z, Zhang Y, Chen L (2023)
The arcuate nucleus mediates GLP-1 receptor agonist liraglutide-dependent weight loss.
Secher A, Jelsing J, Baquero AF, Hecksher-Sørensen J, Cowley MA, Dalbøge LS, Hansen G, Grove KL, Pyke C, Raun K, Schäffer L, Tang-Christensen M, Verma S, Witgen BM, Vrang N, Bjerre Knudsen L (2014)
Liraglutide Promotes Diabetic Wound Healing via Myo1c/Dock5.
Zhang Q, Zhang C, Kang C, Zhu J, He Q, Li H, Tong Q, Wang M, Zhang L, Xiong X, Wang Y, Qu H, Zheng H, Zheng Y (2024)
+ 21 more citations