HGH (Human Growth Hormone)
FDA Approved 🛑 WADA Banned 24 views
🛑 WADA BANNED - Strictly prohibited in competitive sports at all times
Overview
Human Growth Hormone (HGH, Somatropin) is a 191-amino acid single-chain polypeptide naturally produced by somatotroph cells in the anterior pituitary gland. HGH stimulates growth, cell reproduction, and regeneration through direct effects and indirect mechanisms via insulin-like growth factor-1 (IGF-1) production in the liver. FDA-approved indications include growth hormone deficiency in children and adults, Turner syndrome, chronic renal insufficiency, Prader-Willi syndrome, and HIV-associated wasting. Clinical effects include increased lean muscle mass, reduced body fat, improved bone density, enhanced exercise capacity, and support for tissue repair. Research continues into potential applications for aging, wound healing, and metabolic disorders. Recombinant HGH is administered via subcutaneous injection, typically daily. Side effects may include joint pain, carpal tunnel syndrome, fluid retention, and insulin resistance. Growth hormone therapy requires careful monitoring and is contraindicated in patients with active malignancy. The hormone's effects on body composition and quality of life have made it subject to misuse in anti-aging and performance enhancement contexts.
Quick Facts
Formula:C13H11N5O3
Molecular Weight:22
Sequence:MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Mechanism:Directly stimulates protein synthesis, lipolysis, and gluconeogenesis through IGF-1 mediated pathways
⚠️ Safety Information
FDA approved for GHD, Turner syndrome, CKD, PWS, HIV wasting, ISS. 🛑 WADA BANNED. Requires medical supervision. Side effects include arthralgia, edema, carpal tunnel, glucose intolerance.
Research Citations
[hGH and molecular biology].
Goossens M (1986)
Growth hormone.
Bidlingmaier M, Strasburger CJ (2010)
Autocrine hGH stimulates oncogenicity, epithelial-mesenchymal transition and cancer stem cell-like behavior in human colorectal carcinoma.
Wang JJ, Chong QY, Sun XB, You ML, Pandey V, Chen YJ, Zhuang QS, Liu DX, Ma L, Wu ZS, Zhu T, Lobie PE (2017)
Comparison of the antigenicities of native human growth hormone (hGH) and three forms of recombinant hGHs using monoclonal antibodies.
Sawada J, Wada N, Irie M, Tokunaga-Doi T, Ohtsuka E, Ikehara M, Terao T (1986)
The 20-kilodalton (kDa) human growth hormone (hGH) differs from the 22-kDa hGH in the complex formation with cell surface hGH receptor and hGH-binding protein circulating in human plasma.
Wada M, Uchida H, Ikeda M, Tsunekawa B, Naito N, Banba S, Tanaka E, Hashimoto Y, Honjo M (1998)
+ 44 more citations